(data stored in ACNUC7421 zone)

EMBL: AP010803.PE283

AP010803.PE283       Location/Qualifiers
FT   CDS             299128..299427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95117"
FT                   /db_xref="GOA:D4YXN5"
FT                   /db_xref="InterPro:IPR009534"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXN5"
FT                   /protein_id="BAI95117.1"
FT                   /translation="MIENQKIRPAQVVGPLGEPLTLESLPPVDTTRWVVRRKAEVVAAV
FT                   NGGLLTVDEACARYSLTLEEFASWQRAVDRSGMHGLRVTRIQYYKSLYERQQKY"
     MIENQKIRPA QVVGPLGEPL TLESLPPVDT TRWVVRRKAE VVAAVNGGLL TVDEACARYS        60
     LTLEEFASWQ RAVDRSGMHG LRVTRIQYYK SLYERQQKY                               99
//

If you have problems or comments...

PBIL Back to PBIL home page