(data stored in ACNUC7421 zone)

EMBL: AP010803.PE284

AP010803.PE284       Location/Qualifiers
FT   CDS             299586..299840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02840"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95118"
FT                   /db_xref="GOA:D4YXN6"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXN6"
FT                   /protein_id="BAI95118.1"
FT                   /translation="MGIILWLVVGGIIGWLASMVMRTDAQQGILLNIVVGIVGAFVGGL
FT                   IFSGGSINDGLTLYSFLVSLVGAIILLAIVNLVRRGSVR"
     MGIILWLVVG GIIGWLASMV MRTDAQQGIL LNIVVGIVGA FVGGLIFSGG SINDGLTLYS        60
     FLVSLVGAII LLAIVNLVRR GSVR                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page