(data stored in ACNUC7421 zone)

EMBL: AP010803.PE288

AP010803.PE288       Location/Qualifiers
FT   CDS             304844..306106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02880"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95122"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP0"
FT                   /protein_id="BAI95122.1"
FT                   /translation="MKMLAPPRPAASPVHPARRMRIAATGMLIAMAALFLAARATVHLH
FT                   PAVGFVQAFAEAAMVGGLADWFAVTALFRHPLGLPIPHTAIIPRNKDRIGDTLALFLRD
FT                   NFLTPAVVARRMQRLDMAAAAGRFLASPSGGDGRLREGASRLAADILEALDQERLGGMV
FT                   KGAIAQRLRAMNLAPLIGQALEAAMRDGRHAPVMDGIILWADRTLEANDHLIRQMVHDR
FT                   SGKILRWTGLDENLSNAIIDGLRKLLADMAQDPGHSLRLKAEEGLAKLAADLQFDLEMQ
FT                   ARVARIRDEIVDNPAMQRWIDGLWEQARSGLLRAVRDPGKAMAGRLGEALHQLGATLQR
FT                   DARLRFLINRFARRAAVGATAAYGDSIVKLVSETVRGWDAGTVTSRLEHAVGRDLQYIR
FT                   VNGTLVGGLVGLAIHAVDTLL"
     MKMLAPPRPA ASPVHPARRM RIAATGMLIA MAALFLAARA TVHLHPAVGF VQAFAEAAMV        60
     GGLADWFAVT ALFRHPLGLP IPHTAIIPRN KDRIGDTLAL FLRDNFLTPA VVARRMQRLD       120
     MAAAAGRFLA SPSGGDGRLR EGASRLAADI LEALDQERLG GMVKGAIAQR LRAMNLAPLI       180
     GQALEAAMRD GRHAPVMDGI ILWADRTLEA NDHLIRQMVH DRSGKILRWT GLDENLSNAI       240
     IDGLRKLLAD MAQDPGHSLR LKAEEGLAKL AADLQFDLEM QARVARIRDE IVDNPAMQRW       300
     IDGLWEQARS GLLRAVRDPG KAMAGRLGEA LHQLGATLQR DARLRFLINR FARRAAVGAT       360
     AAYGDSIVKL VSETVRGWDA GTVTSRLEHA VGRDLQYIRV NGTLVGGLVG LAIHAVDTLL       420
//

If you have problems or comments...

PBIL Back to PBIL home page