(data stored in ACNUC7421 zone)

EMBL: AP010803.PE290

AP010803.PE290       Location/Qualifiers
FT   CDS             307283..307810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95124"
FT                   /db_xref="GOA:D4YXP2"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP2"
FT                   /protein_id="BAI95124.1"
FT                   /translation="MTAGDSAFASGPAFPYIGGMAIFPRPVSPKSAMSDLWSYFRENRP
FT                   HKWPLLGLSVAFTWVIIWAFIVDANTNTMPTRNQIFYVQSWDANRTDAAIILQQKIDLA
FT                   KREAAIQKRQREMQGVADIFGIDWKKDEARNTARRKEALKQINAQLDQRLAKAEATEKS
FT                   APAPTQSGAAQP"
     MTAGDSAFAS GPAFPYIGGM AIFPRPVSPK SAMSDLWSYF RENRPHKWPL LGLSVAFTWV        60
     IIWAFIVDAN TNTMPTRNQI FYVQSWDANR TDAAIILQQK IDLAKREAAI QKRQREMQGV       120
     ADIFGIDWKK DEARNTARRK EALKQINAQL DQRLAKAEAT EKSAPAPTQS GAAQP            175
//

If you have problems or comments...

PBIL Back to PBIL home page