(data stored in ACNUC7421 zone)

EMBL: AP010803.PE296

AP010803.PE296       Location/Qualifiers
FT   CDS             312634..313278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-02960"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein / RpsU-divergently
FT                   transcribed"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95130"
FT                   /db_xref="GOA:D4YXP8"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP8"
FT                   /protein_id="BAI95130.1"
FT                   /translation="MTLDEVRAALAPILPRHAAFDGWRGEAVAMAAEQCGIDADIAALA
FT                   FPGGAMDMIDAWFASVDSRMLDALPPEKLAALPIRQRITALVETRLTLLARDREALRRA
FT                   QAVMAMPRNAARAARLGWRAADVMWRAAGDAATDLNHYSKRLTLAGVYAATLLVFVDDE
FT                   SDHWAETRAFLARRIEGVMRFERAKARWKGVGGGERLSFARFIGRLRYPAI"
     MTLDEVRAAL APILPRHAAF DGWRGEAVAM AAEQCGIDAD IAALAFPGGA MDMIDAWFAS        60
     VDSRMLDALP PEKLAALPIR QRITALVETR LTLLARDREA LRRAQAVMAM PRNAARAARL       120
     GWRAADVMWR AAGDAATDLN HYSKRLTLAG VYAATLLVFV DDESDHWAET RAFLARRIEG       180
     VMRFERAKAR WKGVGGGERL SFARFIGRLR YPAI                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page