(data stored in ACNUC7421 zone)

EMBL: AP010803.PE301

AP010803.PE301       Location/Qualifiers
FT   CDS             complement(318071..318430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95135"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ3"
FT                   /protein_id="BAI95135.1"
FT                   /translation="MRMRKDRPPLRIRINRHEARCVEAHTGRARFSTRRVSIQLNQIAA
FT                   LDSLVFRDFLIRDRFRSLGNRPRQRGQIQDLPDRLMRVDSRHSPFRHPGLDPGSRFLSE
FT                   SAPGSRQRDPGSSPG"
     MRMRKDRPPL RIRINRHEAR CVEAHTGRAR FSTRRVSIQL NQIAALDSLV FRDFLIRDRF        60
     RSLGNRPRQR GQIQDLPDRL MRVDSRHSPF RHPGLDPGSR FLSESAPGSR QRDPGSSPG        119
//

If you have problems or comments...

PBIL Back to PBIL home page