(data stored in ACNUC7421 zone)

EMBL: AP010803.PE302

AP010803.PE302       Location/Qualifiers
FT   CDS             318563..318904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95136"
FT                   /db_xref="InterPro:IPR030972"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ4"
FT                   /protein_id="BAI95136.1"
FT                   /translation="MTRKTLVALTAAITLALPAANAFAGINDMDVVVDGRTGMETRSIA
FT                   VSMADLNLASTHGVRMADSRITKAAKKVCGWMSGSILPATPDYRACFGEALDGARSDLD
FT                   TLIQAQRQG"
     MTRKTLVALT AAITLALPAA NAFAGINDMD VVVDGRTGME TRSIAVSMAD LNLASTHGVR        60
     MADSRITKAA KKVCGWMSGS ILPATPDYRA CFGEALDGAR SDLDTLIQAQ RQG              113
//

If you have problems or comments...

PBIL Back to PBIL home page