(data stored in ACNUC7421 zone)

EMBL: AP010803.PE304

AP010803.PE304       Location/Qualifiers
FT   CDS             320582..321001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03040"
FT                   /product="hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95138"
FT                   /db_xref="GOA:D4YXQ6"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ6"
FT                   /protein_id="BAI95138.1"
FT                   /translation="MPYWVRNMAGPFNAVFGRFTFTRYLLASICALSADFALFMLLHRL
FT                   GASPALAALGGYSGGLVLHWMISTQFVFEMRKPPTHGQRIAFILSALIGMAITMGLVGG
FT                   LSGLGLPPAMAKLAAVPVSFLSVYAIRKYGIFARA"
     MPYWVRNMAG PFNAVFGRFT FTRYLLASIC ALSADFALFM LLHRLGASPA LAALGGYSGG        60
     LVLHWMISTQ FVFEMRKPPT HGQRIAFILS ALIGMAITMG LVGGLSGLGL PPAMAKLAAV       120
     PVSFLSVYAI RKYGIFARA                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page