(data stored in ACNUC7421 zone)

EMBL: AP010803.PE305

AP010803.PE305       Location/Qualifiers
FT   CDS             320979..322829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95139"
FT                   /db_xref="GOA:D4YXQ7"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ7"
FT                   /protein_id="BAI95139.1"
FT                   /translation="MASSPAPDGGSPSRTASLARWQICVAALLLWALCCAVMLWLFRNG
FT                   LTTLEFRDPDDAMRLQQVRDWLHGQTFRDVSQHRVNPPAGGPMHWSRIVDMPIAALILM
FT                   LQPLLGPVRAELAACALVSLLLLGGLTATVFLAARRAAGGLFVPMLAVVLLLTTPTILV
FT                   QFTPFRIDHHGWQIWMAAVALCGALDARRLRGGVTAGLALAVWLQISSEALPYAALFAG
FT                   AFALRTWFDRREAARIAAYAVTLGGGALLLLLLLRGPGAVLARYCDGLSAAYIWPLLAF
FT                   ALAMPLALRLIGATTVRRRFMATAAAGGAAAGVFLLSGGACLSGDPFKALGPVAYRLWY
FT                   LQVKEGRPIWEQGLLMAGIILLPAVMGLASTIVAAWRAPEREARDRWIVIALLLAGALA
FT                   VAILVLRAMSVAHVLALPGTAWLLLATFQHIQGWSRAVARILVTASVAILLTPAGLCGA
FT                   WILIASGAAEKEQPETVNCRTAALLAPLRALPRSTLFAPLDLGPDILVRTGHSVIGTAH
FT                   HRNATGINAVIDGFTQPPDKALTTIMRLNGGKGPDYLLTCNDMNEIKHYRADFPQGLAA
FT                   ALKRDKPPRWLRPVPSKGPLRIYKVIAQPATKASATPFMQ"
     MASSPAPDGG SPSRTASLAR WQICVAALLL WALCCAVMLW LFRNGLTTLE FRDPDDAMRL        60
     QQVRDWLHGQ TFRDVSQHRV NPPAGGPMHW SRIVDMPIAA LILMLQPLLG PVRAELAACA       120
     LVSLLLLGGL TATVFLAARR AAGGLFVPML AVVLLLTTPT ILVQFTPFRI DHHGWQIWMA       180
     AVALCGALDA RRLRGGVTAG LALAVWLQIS SEALPYAALF AGAFALRTWF DRREAARIAA       240
     YAVTLGGGAL LLLLLLRGPG AVLARYCDGL SAAYIWPLLA FALAMPLALR LIGATTVRRR       300
     FMATAAAGGA AAGVFLLSGG ACLSGDPFKA LGPVAYRLWY LQVKEGRPIW EQGLLMAGII       360
     LLPAVMGLAS TIVAAWRAPE REARDRWIVI ALLLAGALAV AILVLRAMSV AHVLALPGTA       420
     WLLLATFQHI QGWSRAVARI LVTASVAILL TPAGLCGAWI LIASGAAEKE QPETVNCRTA       480
     ALLAPLRALP RSTLFAPLDL GPDILVRTGH SVIGTAHHRN ATGINAVIDG FTQPPDKALT       540
     TIMRLNGGKG PDYLLTCNDM NEIKHYRADF PQGLAAALKR DKPPRWLRPV PSKGPLRIYK       600
     VIAQPATKAS ATPFMQ                                                       616
//

If you have problems or comments...

PBIL Back to PBIL home page