(data stored in ACNUC7421 zone)

EMBL: AP010803.PE306

AP010803.PE306       Location/Qualifiers
FT   CDS             complement(322787..323272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="SJA_C1-03060"
FT                   /product="peptide-methionine (R)-S-oxide reductase"
FT                   /EC_number="1.8.4.12"
FT                   /note="putative methionine sulfoxidereductase, SelR /
FT                   conserved domain frequently associated with peptide
FT                   methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95140"
FT                   /db_xref="GOA:D4YXQ8"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ8"
FT                   /protein_id="BAI95140.1"
FT                   /translation="MAGPMNRRRFLGMGGCAATMIVLWQAGLGRAAAYPFTLSDAEWRR
FT                   RLSPLAYQVLRKRSTEHPFTSPLNKEHRPGVFACAGCGQRLFSSKTKFDSGTGWPSFWA
FT                   PLPRAVGTSRDFELGYPRTEVHCARCGGHLGHVFDDGPKPTGKRYCMNGVALAFVAG"
     MAGPMNRRRF LGMGGCAATM IVLWQAGLGR AAAYPFTLSD AEWRRRLSPL AYQVLRKRST        60
     EHPFTSPLNK EHRPGVFACA GCGQRLFSSK TKFDSGTGWP SFWAPLPRAV GTSRDFELGY       120
     PRTEVHCARC GGHLGHVFDD GPKPTGKRYC MNGVALAFVA G                           161
//

If you have problems or comments...

PBIL Back to PBIL home page