(data stored in ACNUC7421 zone)

EMBL: AP010803.PE309

AP010803.PE309       Location/Qualifiers
FT   CDS             325467..326489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03090"
FT                   /product="putative Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95143"
FT                   /db_xref="GOA:D4YXR1"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXR1"
FT                   /protein_id="BAI95143.1"
FT                   /translation="MEQRLKAEARRLGFAACAIAPANAAPRSAERLRQWLDAGHHGEML
FT                   WMEERAGQRGSPQGLWPDVRSVVMLGMSYAPGRDPLALADARDRGRISVYAQGRDYHDV
FT                   VKKGLKALARWLVEQHPGALKVFVDTAPVMEKPLAQAAGLGWQGKHSNLVSRTHGSWLF
FT                   LGAIYSEIALVPDAPEDDHCGSCTACQTACPTDAFPAPYVVDARRCISYLTIEHKGPIP
FT                   EELRAGIGNRVYGCDDCLAVCPWNKFADAAAANRAFVGRAELAAPELGDLLALDDAGFR
FT                   EIFAGSPIKRIGRNRMVRNAAIAAGNSGDRRLVGRLQALAAADDPVVAEAARWALERLG
FT                   "
     MEQRLKAEAR RLGFAACAIA PANAAPRSAE RLRQWLDAGH HGEMLWMEER AGQRGSPQGL        60
     WPDVRSVVML GMSYAPGRDP LALADARDRG RISVYAQGRD YHDVVKKGLK ALARWLVEQH       120
     PGALKVFVDT APVMEKPLAQ AAGLGWQGKH SNLVSRTHGS WLFLGAIYSE IALVPDAPED       180
     DHCGSCTACQ TACPTDAFPA PYVVDARRCI SYLTIEHKGP IPEELRAGIG NRVYGCDDCL       240
     AVCPWNKFAD AAAANRAFVG RAELAAPELG DLLALDDAGF REIFAGSPIK RIGRNRMVRN       300
     AAIAAGNSGD RRLVGRLQAL AAADDPVVAE AARWALERLG                             340
//

If you have problems or comments...

PBIL Back to PBIL home page