(data stored in ACNUC7421 zone)

EMBL: AP010803.PE31

AP010803.PE31        Location/Qualifiers
FT   CDS             complement(31319..31579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94865"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWY3"
FT                   /protein_id="BAI94865.1"
FT                   /translation="MKVSVDVDCTPAEARAFLGLPDVTPIHDKYVKTMLDSFDGVANVE
FT                   QMETLFRSFSPLGDAGMRLFKQMMDIGLAGMPGKNGDKNPG"
     MKVSVDVDCT PAEARAFLGL PDVTPIHDKY VKTMLDSFDG VANVEQMETL FRSFSPLGDA        60
     GMRLFKQMMD IGLAGMPGKN GDKNPG                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page