(data stored in ACNUC7421 zone)

EMBL: AP010803.PE311

AP010803.PE311       Location/Qualifiers
FT   CDS             complement(326927..327607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03110"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein involved in cysteine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95145"
FT                   /db_xref="GOA:D4YXR3"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXR3"
FT                   /protein_id="BAI95145.1"
FT                   /translation="MVLAAALRAFPSIFHGAALRLLVKTLLLTLLAFALLAAALWTGIH
FT                   AARLHFGWATGAGWGGLAEATATAIAVIAVGWLLFRATAMAIMSLFADDIIVAVERDSY
FT                   TAAAARARPVGWGRSLGFALRSVLRTLGWNLLALPAYLLLLVTGIGTLGLFLILNAALL
FT                   GRDMADMVEPRHPDLPPIPRGGRWLMGLASALIFLVPGLNLLAPIWSAAMAVHMLHGAR
FT                   RNMP"
     MVLAAALRAF PSIFHGAALR LLVKTLLLTL LAFALLAAAL WTGIHAARLH FGWATGAGWG        60
     GLAEATATAI AVIAVGWLLF RATAMAIMSL FADDIIVAVE RDSYTAAAAR ARPVGWGRSL       120
     GFALRSVLRT LGWNLLALPA YLLLLVTGIG TLGLFLILNA ALLGRDMADM VEPRHPDLPP       180
     IPRGGRWLMG LASALIFLVP GLNLLAPIWS AAMAVHMLHG ARRNMP                      226
//

If you have problems or comments...

PBIL Back to PBIL home page