(data stored in ACNUC7421 zone)

EMBL: AP010803.PE313

AP010803.PE313       Location/Qualifiers
FT   CDS             complement(328759..330255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03130"
FT                   /product="putative polysaccharide transporter"
FT                   /note="membrane protein involved in the export of O-antigen
FT                   and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95147"
FT                   /db_xref="GOA:D4YXR5"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXR5"
FT                   /protein_id="BAI95147.1"
FT                   /translation="MAAEGASPAQQDDIAALAKGGRTNVFGFLLRLAARLPFLFIAGRW
FT                   YGADALGRFAYAVLVVEFVAQLATLGLKRGLAGALSQTERPHSHVVTDAMVVTLIASLI
FT                   GSALLVAFPQAMFPNSGINGLDRLLALIVIAVAGSDVALAACAYRFDIGATVRARSIIE
FT                   PWAISIGAFGFAYYSTRDGLILSYVVSMIAALVASIIPMTRHYGIPYGWRPDFGRLWRL
FT                   ARRNLPLAAADGVEWGSRRLDMAILGLFVSPAVVGIYYVAQQVASLPQKLKTSFDPILG
FT                   PVITRNLSEGNLTAIARQVSQVGFWIIAAQAGIALALGIPGEAVMGLVGPHFVGGTGAL
FT                   AFLLLAEVVAATAVVSESALVYIARHRNLMISLLMIVLQAALSFLLIFAARRLGLRDMA
FT                   VAAAPALALSIALGVSALVKARLLSTLLGARVNAWRWPLLSASGVACIVGAAFVALPPD
FT                   FEWVELVFGVFTILGVYGFVIWRWGFGPDDRALFRKQKAA"
     MAAEGASPAQ QDDIAALAKG GRTNVFGFLL RLAARLPFLF IAGRWYGADA LGRFAYAVLV        60
     VEFVAQLATL GLKRGLAGAL SQTERPHSHV VTDAMVVTLI ASLIGSALLV AFPQAMFPNS       120
     GINGLDRLLA LIVIAVAGSD VALAACAYRF DIGATVRARS IIEPWAISIG AFGFAYYSTR       180
     DGLILSYVVS MIAALVASII PMTRHYGIPY GWRPDFGRLW RLARRNLPLA AADGVEWGSR       240
     RLDMAILGLF VSPAVVGIYY VAQQVASLPQ KLKTSFDPIL GPVITRNLSE GNLTAIARQV       300
     SQVGFWIIAA QAGIALALGI PGEAVMGLVG PHFVGGTGAL AFLLLAEVVA ATAVVSESAL       360
     VYIARHRNLM ISLLMIVLQA ALSFLLIFAA RRLGLRDMAV AAAPALALSI ALGVSALVKA       420
     RLLSTLLGAR VNAWRWPLLS ASGVACIVGA AFVALPPDFE WVELVFGVFT ILGVYGFVIW       480
     RWGFGPDDRA LFRKQKAA                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page