(data stored in ACNUC7421 zone)

EMBL: AP010803.PE318

AP010803.PE318       Location/Qualifiers
FT   CDS             333994..334878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95152"
FT                   /db_xref="GOA:D4YXS0"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXS0"
FT                   /protein_id="BAI95152.1"
FT                   /translation="MEEKPLMSDMDAPASGATGPLPARRGPWLLALLVLLAFAVGVVLT
FT                   VLALPRIQRWNAPQRPSVLSDPLLNAVAPGVPMRPLSADAGQMLDARVVQLEERLNRIT
FT                   VEAQAASGNAARAEGLLVAFAARRALDSGASLGYIEGQLRLRFGQAQPRAVATIINAAR
FT                   EPVTLPDLRAGLTALADQVTVPPANASWWEALEHEAREIITIHRASTPSPRPQAALDRA
FT                   LRYLDGSRVGAALAEVEQMPGRAAADRWMQYARRYMEARRALDLIETAAILEPRQLRAA
FT                   DGAAVAQTSPLAP"
     MEEKPLMSDM DAPASGATGP LPARRGPWLL ALLVLLAFAV GVVLTVLALP RIQRWNAPQR        60
     PSVLSDPLLN AVAPGVPMRP LSADAGQMLD ARVVQLEERL NRITVEAQAA SGNAARAEGL       120
     LVAFAARRAL DSGASLGYIE GQLRLRFGQA QPRAVATIIN AAREPVTLPD LRAGLTALAD       180
     QVTVPPANAS WWEALEHEAR EIITIHRAST PSPRPQAALD RALRYLDGSR VGAALAEVEQ       240
     MPGRAAADRW MQYARRYMEA RRALDLIETA AILEPRQLRA ADGAAVAQTS PLAP             294
//

If you have problems or comments...

PBIL Back to PBIL home page