(data stored in ACNUC7421 zone)

EMBL: AP010803.PE319

AP010803.PE319       Location/Qualifiers
FT   CDS             335002..335751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95153"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXS1"
FT                   /protein_id="BAI95153.1"
FT                   /translation="MPPYADAIASFWKARLASGPRAAERPPLQHLLGNASLPFDLARTR
FT                   ARAPQLAQAIRGDGRRILLIPGLLASEHRMEPLRAVLNAAGYEAHGWGMGRNFGPRPDS
FT                   LEQIDRRVDAIRRETGAPVTLVGWSLGGLFAREYAKFATRKVGGVVTMGTPFSGDPRAN
FT                   HAWRLYQLVSGFPVDRPPFTCRREEKPPVPTVALWSRRDGVILPRCAKGRAGERDRAIE
FT                   VDCTHMGFAAAPEGILAVGEALEAMRG"
     MPPYADAIAS FWKARLASGP RAAERPPLQH LLGNASLPFD LARTRARAPQ LAQAIRGDGR        60
     RILLIPGLLA SEHRMEPLRA VLNAAGYEAH GWGMGRNFGP RPDSLEQIDR RVDAIRRETG       120
     APVTLVGWSL GGLFAREYAK FATRKVGGVV TMGTPFSGDP RANHAWRLYQ LVSGFPVDRP       180
     PFTCRREEKP PVPTVALWSR RDGVILPRCA KGRAGERDRA IEVDCTHMGF AAAPEGILAV       240
     GEALEAMRG                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page