(data stored in ACNUC7421 zone)

EMBL: AP010803.PE32

AP010803.PE32        Location/Qualifiers
FT   CDS             31738..32436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00320"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="dienelactone hydrolase or related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94866"
FT                   /db_xref="GOA:D4YWY4"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWY4"
FT                   /protein_id="BAI94866.1"
FT                   /translation="MAAFTSIPTLEGDARFDVFVARPEGAPKAAIVVIQEIFGVNEGIR
FT                   RKCDSWAAAGYLAMAPDLFWREKPHVELDADIGEELQAAFGHMQKFNQDQGIRDIEATI
FT                   KAARAELGQGGKVGLVGYCLGGRLAFMSACRTDGDAFVAYYGVGIDGLLNEQHAIGKPV
FT                   LLHVPTADGFVPPDVQRKMHEGLKDNRHVTLHDYEGLDHGFAAEMGARRNEAAAQLADG
FT                   RTADFFAAHL"
     MAAFTSIPTL EGDARFDVFV ARPEGAPKAA IVVIQEIFGV NEGIRRKCDS WAAAGYLAMA        60
     PDLFWREKPH VELDADIGEE LQAAFGHMQK FNQDQGIRDI EATIKAARAE LGQGGKVGLV       120
     GYCLGGRLAF MSACRTDGDA FVAYYGVGID GLLNEQHAIG KPVLLHVPTA DGFVPPDVQR       180
     KMHEGLKDNR HVTLHDYEGL DHGFAAEMGA RRNEAAAQLA DGRTADFFAA HL               232
//

If you have problems or comments...

PBIL Back to PBIL home page