(data stored in ACNUC7421 zone)

EMBL: AP010803.PE324

AP010803.PE324       Location/Qualifiers
FT   CDS             complement(340478..340909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03240"
FT                   /product="glyoxalase-family protein"
FT                   /note="glyoxalase / bleomycin resistance protein /
FT                   dioxygenase / uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95158"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXS6"
FT                   /protein_id="BAI95158.1"
FT                   /translation="MMPGSPVIPALRYADAPAAIRFLCQAFGFEVQASYEDAEDPHIIH
FT                   HAQLVLGEGMVMLGSARDGEAESLYSWTTPRELGGVTACIYVVVPDADAHCLHARNEGA
FT                   VVVSEPHDNDGYPGRGYEALDPEGNVWSFGTYDPWAHFA"
     MMPGSPVIPA LRYADAPAAI RFLCQAFGFE VQASYEDAED PHIIHHAQLV LGEGMVMLGS        60
     ARDGEAESLY SWTTPRELGG VTACIYVVVP DADAHCLHAR NEGAVVVSEP HDNDGYPGRG       120
     YEALDPEGNV WSFGTYDPWA HFA                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page