(data stored in ACNUC7421 zone)

EMBL: AP010803.PE325

AP010803.PE325       Location/Qualifiers
FT   CDS             341035..341820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03250"
FT                   /product="putative fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="archaeal fructose-1,6-bisphosphatase or related
FT                   enzyme of inositol monophosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95159"
FT                   /db_xref="GOA:D4YXS7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR011809"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXS7"
FT                   /protein_id="BAI95159.1"
FT                   /translation="MTTRDDLALANRLADAARAAIRPFFRARYDMEFKSDQSPVTEADR
FT                   AAEAAIRAILEKERPQDGIIGEEYGAAREDAERVWILDPIDGTRSFIAGRPIFGTLIAL
FT                   TQAGWPTIGIIDQPIADERWAGMMGQPTTFNGRPVTTRACRALDQAILASTAPQLFPGC
FT                   TAEHFSRLAGQCRDTVWGGDCYNYGLVASGHVDIVVEAGLKLHDLAALVPVVEGAGGRM
FT                   CDWAGEPLTHDSDGRVIALGDAARLDDVLEALAEGHEDH"
     MTTRDDLALA NRLADAARAA IRPFFRARYD MEFKSDQSPV TEADRAAEAA IRAILEKERP        60
     QDGIIGEEYG AAREDAERVW ILDPIDGTRS FIAGRPIFGT LIALTQAGWP TIGIIDQPIA       120
     DERWAGMMGQ PTTFNGRPVT TRACRALDQA ILASTAPQLF PGCTAEHFSR LAGQCRDTVW       180
     GGDCYNYGLV ASGHVDIVVE AGLKLHDLAA LVPVVEGAGG RMCDWAGEPL THDSDGRVIA       240
     LGDAARLDDV LEALAEGHED H                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page