(data stored in ACNUC7421 zone)

EMBL: AP010803.PE327

AP010803.PE327       Location/Qualifiers
FT   CDS             complement(343860..344276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95161"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXS9"
FT                   /protein_id="BAI95161.1"
FT                   /translation="MRPWILGSGLCLAPLLLAGCSGTHEPPRLTEKQTSELERALAGKV
FT                   PGEKTSCVNRESQSNLTAISNSVLLYRVSRRLVYRNDLIGSCSGLSRGDTLIIRTWGSQ
FT                   YCRGDQITSADLMTGMVTGNCALGDFTPYRAPSK"
     MRPWILGSGL CLAPLLLAGC SGTHEPPRLT EKQTSELERA LAGKVPGEKT SCVNRESQSN        60
     LTAISNSVLL YRVSRRLVYR NDLIGSCSGL SRGDTLIIRT WGSQYCRGDQ ITSADLMTGM       120
     VTGNCALGDF TPYRAPSK                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page