(data stored in ACNUC7421 zone)

EMBL: AP010803.PE330

AP010803.PE330       Location/Qualifiers
FT   CDS             345596..346300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03300"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95164"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXT2"
FT                   /protein_id="BAI95164.1"
FT                   /translation="MALTYHDKLLLGCAAVLALGMVGGGYLLGDGLKRARAADRSVTVR
FT                   GLAEKDVTADLATWSISYSATGFDLPAVRAEIDNNTRELRAYFASLGFKPDALTATGAG
FT                   VNQYINNGVNTITITQRMLLRTTDIARAQRAVAQQFDLVRRGVTLQEGSGMRYSFTRLN
FT                   DVKPPMVAAATRDARAAAEQFARDSGASVGGIKSATQGYFSIEARDGEADGSSDTPYKK
FT                   VRVVTTVDFYLN"
     MALTYHDKLL LGCAAVLALG MVGGGYLLGD GLKRARAADR SVTVRGLAEK DVTADLATWS        60
     ISYSATGFDL PAVRAEIDNN TRELRAYFAS LGFKPDALTA TGAGVNQYIN NGVNTITITQ       120
     RMLLRTTDIA RAQRAVAQQF DLVRRGVTLQ EGSGMRYSFT RLNDVKPPMV AAATRDARAA       180
     AEQFARDSGA SVGGIKSATQ GYFSIEARDG EADGSSDTPY KKVRVVTTVD FYLN             234
//

If you have problems or comments...

PBIL Back to PBIL home page