(data stored in SCRATCH zone)

EMBL: AP010803.PE331

AP010803.PE331       Location/Qualifiers
FT   CDS             complement(346304..346513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03310"
FT                   /product="phage-related protein"
FT                   /note="phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95165"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXT3"
FT                   /protein_id="BAI95165.1"
FT                   /translation="MQDRHGKFAALALLAASALALTACSHGATRGGLIGGAGGAVVGSA
FT                   TGLGTVEGAVIGGAAGAIIGDDKD"
     MQDRHGKFAA LALLAASALA LTACSHGATR GGLIGGAGGA VVGSATGLGT VEGAVIGGAA        60
     GAIIGDDKD                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page