(data stored in ACNUC7421 zone)

EMBL: AP010803.PE332

AP010803.PE332       Location/Qualifiers
FT   CDS             complement(346591..347445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03320"
FT                   /product="TPR repeat protein"
FT                   /note="FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95166"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXT4"
FT                   /protein_id="BAI95166.1"
FT                   /translation="MPFLLPLLLLAPQAYDPEVEAVMNRKRKERAEASAVVAPVAQASD
FT                   GRIPVPDRYAAKFQACLDQAAEAPDKGVAFAQQWRIEGGSFYARNCMGFAYARAERWAP
FT                   AIVAFEQGADEAERNGEMAQSARLWAQAGNAALAGGDAAKARDDFDAALARGLPDGMEK
FT                   GEVHLDRARALVALNDGGSARASLDIALEQVPQDPLAWLLSATLARRSGEMKLAQAHIA
FT                   RAVQLSPDDASVALEEGNIAILTDHEDVARSAWQRAVKLAADAPAGRAAADNLSRLPPK
FT                   PAD"
     MPFLLPLLLL APQAYDPEVE AVMNRKRKER AEASAVVAPV AQASDGRIPV PDRYAAKFQA        60
     CLDQAAEAPD KGVAFAQQWR IEGGSFYARN CMGFAYARAE RWAPAIVAFE QGADEAERNG       120
     EMAQSARLWA QAGNAALAGG DAAKARDDFD AALARGLPDG MEKGEVHLDR ARALVALNDG       180
     GSARASLDIA LEQVPQDPLA WLLSATLARR SGEMKLAQAH IARAVQLSPD DASVALEEGN       240
     IAILTDHEDV ARSAWQRAVK LAADAPAGRA AADNLSRLPP KPAD                        284
//

If you have problems or comments...

PBIL Back to PBIL home page