(data stored in ACNUC7421 zone)

EMBL: AP010803.PE336

AP010803.PE336       Location/Qualifiers
FT   CDS             350191..350439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95170"
FT                   /db_xref="GOA:D4YXT8"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXT8"
FT                   /protein_id="BAI95170.1"
FT                   /translation="MRPPAHRYKFTIMSDAEYEWKPRPPNLRERIIAGVFVAVLLVTLA
FT                   SEYAGWGLFADYEKQVMGLLILIGLILLRFAPSVHRR"
     MRPPAHRYKF TIMSDAEYEW KPRPPNLRER IIAGVFVAVL LVTLASEYAG WGLFADYEKQ        60
     VMGLLILIGL ILLRFAPSVH RR                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page