(data stored in ACNUC7421 zone)

EMBL: AP010803.PE339

AP010803.PE339       Location/Qualifiers
FT   CDS             351564..352109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95173"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU1"
FT                   /protein_id="BAI95173.1"
FT                   /translation="MIETRQQGAQPLVPQELGSGGGGGVVGEAVAVDLGGGRVIFALLS
FT                   GPEGRSIYAMVPRVLNYPDLKPPLSRQFKLHEWQEAYDEAEDVKPFAVLRREDYPMLVS
FT                   FGDLGNPKSVGAVNPDMVGVRRITLQVTDDPVTTGIEKRLGWLGAYPESRLDGVYRGDT
FT                   GMPLARRLSNGDFRMEPI"
     MIETRQQGAQ PLVPQELGSG GGGGVVGEAV AVDLGGGRVI FALLSGPEGR SIYAMVPRVL        60
     NYPDLKPPLS RQFKLHEWQE AYDEAEDVKP FAVLRREDYP MLVSFGDLGN PKSVGAVNPD       120
     MVGVRRITLQ VTDDPVTTGI EKRLGWLGAY PESRLDGVYR GDTGMPLARR LSNGDFRMEP       180
     I                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page