(data stored in ACNUC7421 zone)

EMBL: AP010803.PE340

AP010803.PE340       Location/Qualifiers
FT   CDS             352115..352384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95174"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU2"
FT                   /protein_id="BAI95174.1"
FT                   /translation="MMIGFLRWQLCSFVQKKLPARKPPSLVIAARNSDGLGPQPTSSVL
FT                   SPAAGLLSKPEPDQRVMATQSDSLAVSDDAWWEGDGPLSSMAWW"
     MMIGFLRWQL CSFVQKKLPA RKPPSLVIAA RNSDGLGPQP TSSVLSPAAG LLSKPEPDQR        60
     VMATQSDSLA VSDDAWWEGD GPLSSMAWW                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page