(data stored in ACNUC7421 zone)

EMBL: AP010803.PE343

AP010803.PE343       Location/Qualifiers
FT   CDS             complement(353608..354192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95177"
FT                   /db_xref="GOA:D4YXU5"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU5"
FT                   /protein_id="BAI95177.1"
FT                   /translation="MFSNPHFERVRQMFADQFEPDGDSFLYRKSMKGAPVRVSGTERDE
FT                   FVKSFNRRLRYAMWLIFPATLILIGLLVWLVPDVNSAAGHVATYAGIAVILAPFLASYY
FT                   WAWNAPSRELQRRPAEGVARSREEVRRLMFSKMTYGQLGFVALAGIALVWKALGDTDIF
FT                   HGWGVLWLLFAALLIAAAGAQAIRKWRYERG"
     MFSNPHFERV RQMFADQFEP DGDSFLYRKS MKGAPVRVSG TERDEFVKSF NRRLRYAMWL        60
     IFPATLILIG LLVWLVPDVN SAAGHVATYA GIAVILAPFL ASYYWAWNAP SRELQRRPAE       120
     GVARSREEVR RLMFSKMTYG QLGFVALAGI ALVWKALGDT DIFHGWGVLW LLFAALLIAA       180
     AGAQAIRKWR YERG                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page