(data stored in ACNUC7421 zone)

EMBL: AP010803.PE346

AP010803.PE346       Location/Qualifiers
FT   CDS             354804..356846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03460"
FT                   /product="transglutaminase-like protein"
FT                   /note="transglutaminase-like enzyme, putative cysteine
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95180"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU8"
FT                   /protein_id="BAI95180.1"
FT                   /translation="MLRSIIGLTVAAIAANTALAADKVQYGKPAAWVLPTPAPTEGIAQ
FT                   VGAAARTIYSDTQTRVGDKGDDIYTAWRIRLLTADALSIGNIAASWNPASGSATVHHLR
FT                   IWRDGKPIDVLKKARFAVVRQEVNLEASMLTGILTASLQTPGLQVGDELEFAATIHGQD
FT                   PTLGDHHFGLSALPPQGNPGAYRMRLSWPAGQTLRWQGTADMGELTPKAEDNYKAVDYT
FT                   LRDPKSATPTDGAPARYNVRRLLEYSDFTDWADVSRRMWGLFDEASALKPGSPLRQEIA
FT                   KIAAADKNPAARAEAALALVQNHIRYVYVGLNGGNYRPATIDESWTRRFGDCKAKTALL
FT                   LAILRELDVPAEAVLVQTAGGDGLDQRLPSPVLFDHVLVRATIGDKPYWLDGTRLGDQH
FT                   LALIPPPSFRWVLPLRKEGGTLEAVAPTAPKEPQLIGFEEVDMREGIAKPARVTLRNIL
FT                   RGDEIYAMRTMLASLSPEEADRQLQSYWQQQADWVDADKVEWRYAENQAALILTLTGRG
FT                   KLEWKGSDQDGWYSYMHGAGLYAPNKRKRPKEQDQSAPFAIEFPRFRCWATVLRLPKPN
FT                   GNWHWNVAGKRMNRTLGGVAYWRGISINDNVVRSVQSTRSLTPEISAEDVRTANDLIPG
FT                   FDNDMTRVEQDFTLKADVGRSEPMLDKGDQIDWAASNTPCQGPGK"
     MLRSIIGLTV AAIAANTALA ADKVQYGKPA AWVLPTPAPT EGIAQVGAAA RTIYSDTQTR        60
     VGDKGDDIYT AWRIRLLTAD ALSIGNIAAS WNPASGSATV HHLRIWRDGK PIDVLKKARF       120
     AVVRQEVNLE ASMLTGILTA SLQTPGLQVG DELEFAATIH GQDPTLGDHH FGLSALPPQG       180
     NPGAYRMRLS WPAGQTLRWQ GTADMGELTP KAEDNYKAVD YTLRDPKSAT PTDGAPARYN       240
     VRRLLEYSDF TDWADVSRRM WGLFDEASAL KPGSPLRQEI AKIAAADKNP AARAEAALAL       300
     VQNHIRYVYV GLNGGNYRPA TIDESWTRRF GDCKAKTALL LAILRELDVP AEAVLVQTAG       360
     GDGLDQRLPS PVLFDHVLVR ATIGDKPYWL DGTRLGDQHL ALIPPPSFRW VLPLRKEGGT       420
     LEAVAPTAPK EPQLIGFEEV DMREGIAKPA RVTLRNILRG DEIYAMRTML ASLSPEEADR       480
     QLQSYWQQQA DWVDADKVEW RYAENQAALI LTLTGRGKLE WKGSDQDGWY SYMHGAGLYA       540
     PNKRKRPKEQ DQSAPFAIEF PRFRCWATVL RLPKPNGNWH WNVAGKRMNR TLGGVAYWRG       600
     ISINDNVVRS VQSTRSLTPE ISAEDVRTAN DLIPGFDNDM TRVEQDFTLK ADVGRSEPML       660
     DKGDQIDWAA SNTPCQGPGK                                                   680
//

If you have problems or comments...

PBIL Back to PBIL home page