(data stored in SCRATCH zone)

EMBL: AP010803.PE347

AP010803.PE347       Location/Qualifiers
FT   CDS             complement(356878..357504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="SJA_C1-03470"
FT                   /product="TonB-like protein"
FT                   /note="periplasmic protein TonB, links inner and outer
FT                   membranes"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95181"
FT                   /db_xref="GOA:D4YXU9"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXU9"
FT                   /protein_id="BAI95181.1"
FT                   /translation="MLLHDRRMKNARISLSVLSLISVAAVPAPAEPKHRATPLTSPGTW
FT                   FTDADYPMDAARAEIEGTTVFRLEINSAGVPQRCIITTSSGSASLDNATCDKLMVRARF
FT                   TIPKDARGRSVSDIYNGRITWRLPDTNAPARLPSIPHMMKVTFYVNPDGTTSDCIATLN
FT                   DVEPGPPEICATQVLNRHFPVQNDASGKPVRQKLRMVMGIEKVAD"
     MLLHDRRMKN ARISLSVLSL ISVAAVPAPA EPKHRATPLT SPGTWFTDAD YPMDAARAEI        60
     EGTTVFRLEI NSAGVPQRCI ITTSSGSASL DNATCDKLMV RARFTIPKDA RGRSVSDIYN       120
     GRITWRLPDT NAPARLPSIP HMMKVTFYVN PDGTTSDCIA TLNDVEPGPP EICATQVLNR       180
     HFPVQNDASG KPVRQKLRMV MGIEKVAD                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page