(data stored in ACNUC7421 zone)

EMBL: AP010803.PE351

AP010803.PE351       Location/Qualifiers
FT   CDS             360777..361139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95185"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXV3"
FT                   /protein_id="BAI95185.1"
FT                   /translation="MGVQIEAMDGGKLKLTGDVETVLTLPASAVTDGFSFAFSDGTLLR
FT                   GHHDIGSGRCHFELGAQGAASVRIMREGRHDSARIDGQIEWMTLACGSRTLCPIHAKPH
FT                   DDGRQLVLDMDARQAA"
     MGVQIEAMDG GKLKLTGDVE TVLTLPASAV TDGFSFAFSD GTLLRGHHDI GSGRCHFELG        60
     AQGAASVRIM REGRHDSARI DGQIEWMTLA CGSRTLCPIH AKPHDDGRQL VLDMDARQAA       120
//

If you have problems or comments...

PBIL Back to PBIL home page