(data stored in ACNUC7421 zone)

EMBL: AP010803.PE353

AP010803.PE353       Location/Qualifiers
FT   CDS             complement(362134..362391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03530"
FT                   /product="ECF-type sigma factor"
FT                   /note="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95187"
FT                   /db_xref="GOA:D4YXV5"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXV5"
FT                   /protein_id="BAI95187.1"
FT                   /translation="MTDTPDLERLERLEAALLTMPRLRREIFLAVRLDAMRYEDVARIT
FT                   GLSVRAVERQMARAIAHIGYHLRHGAAQPPRRWWYRRRGK"
     MTDTPDLERL ERLEAALLTM PRLRREIFLA VRLDAMRYED VARITGLSVR AVERQMARAI        60
     AHIGYHLRHG AAQPPRRWWY RRRGK                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page