(data stored in SCRATCH zone)

EMBL: AP010803.PE355

AP010803.PE355       Location/Qualifiers
FT   CDS             364337..364483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95189"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXV7"
FT                   /protein_id="BAI95189.1"
FT                   /translation="MKPELRPGAAGLKGSDAHPPDRRRQGQRRRAAGVATIGTVRSSGT
FT                   RVI"
     MKPELRPGAA GLKGSDAHPP DRRRQGQRRR AAGVATIGTV RSSGTRVI                     48
//

If you have problems or comments...

PBIL Back to PBIL home page