(data stored in SCRATCH zone)

EMBL: AP010803.PE356

AP010803.PE356       Location/Qualifiers
FT   CDS             364495..364656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95190"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXV8"
FT                   /protein_id="BAI95190.1"
FT                   /translation="MGRDARRGWLGGAKRNRAGSRHQRETLIMSANGTLRSVRFEAPKE
FT                   EAGHSDRI"
     MGRDARRGWL GGAKRNRAGS RHQRETLIMS ANGTLRSVRF EAPKEEAGHS DRI               53
//

If you have problems or comments...

PBIL Back to PBIL home page