(data stored in ACNUC7421 zone)

EMBL: AP010803.PE357

AP010803.PE357       Location/Qualifiers
FT   CDS             364957..367017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03570"
FT                   /product="putative signal transduction protein"
FT                   /note="putative signal transduction protein containing a
FT                   membrane domain, an EAL and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95191"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXV9"
FT                   /protein_id="BAI95191.1"
FT                   /translation="MEKVSDKVIARAARALRGDPSLPNSHDLQAVLVRCWTRALGHFCR
FT                   SYDTKTGAFAERLYLNDIVKLCDDLAKAGLQADLGDFDQARLRIALSDPSMRLDRTNTI
FT                   DLIAFLETHLGSMPDGIRSALLDGIPPDCPGWSSCFSLFVTEEMKSSPKVFQIFVTERL
FT                   ATIEALAEASAQTTDRIETSLGDLARTSTETGHDIRWIVDRLKQLPSLDDTDLTEIAAF
FT                   FGIFDADGAAAARKAIMVKARELGVLKDRVVEYEAAERELTRIAFVDHLTGAPNRSHFY
FT                   RELGDRSRRTDNAAFVRHLAFLDIDGFHQINNAWGHDAGDHVLSEIARRLQDLALASEA
FT                   IFCRYGGDEFLLGFEAQEVETERLQNLAEAARKAVSAPISYLAQTLRVTASVGLSADDA
FT                   DVVIERSIKSADLALYRAKESGRDRAVLFEQRFHEDVEERRALEVALRTAIENEELRLR
FT                   YAPVVDLATENIVGFEALVRWHNPDRGWISPVTFVPVAEECGLIRLIGDWVLRTACADA
FT                   TQWLRPIPVAVNISPLQWDESLIGNLQSVLAETRLSPERLELEVTESIFLIDTAECFAL
FT                   AKQIDALGIGLVLDDFGTGFSSLSCLGRTPFKSIKIDQSFIRSAVGGDAGSSAIIHGTV
FT                   TMARALEIEITAEGIETEADLLLAKELGCTRAQGFYFAKPMDAEAVRQAIS"
     MEKVSDKVIA RAARALRGDP SLPNSHDLQA VLVRCWTRAL GHFCRSYDTK TGAFAERLYL        60
     NDIVKLCDDL AKAGLQADLG DFDQARLRIA LSDPSMRLDR TNTIDLIAFL ETHLGSMPDG       120
     IRSALLDGIP PDCPGWSSCF SLFVTEEMKS SPKVFQIFVT ERLATIEALA EASAQTTDRI       180
     ETSLGDLART STETGHDIRW IVDRLKQLPS LDDTDLTEIA AFFGIFDADG AAAARKAIMV       240
     KARELGVLKD RVVEYEAAER ELTRIAFVDH LTGAPNRSHF YRELGDRSRR TDNAAFVRHL       300
     AFLDIDGFHQ INNAWGHDAG DHVLSEIARR LQDLALASEA IFCRYGGDEF LLGFEAQEVE       360
     TERLQNLAEA ARKAVSAPIS YLAQTLRVTA SVGLSADDAD VVIERSIKSA DLALYRAKES       420
     GRDRAVLFEQ RFHEDVEERR ALEVALRTAI ENEELRLRYA PVVDLATENI VGFEALVRWH       480
     NPDRGWISPV TFVPVAEECG LIRLIGDWVL RTACADATQW LRPIPVAVNI SPLQWDESLI       540
     GNLQSVLAET RLSPERLELE VTESIFLIDT AECFALAKQI DALGIGLVLD DFGTGFSSLS       600
     CLGRTPFKSI KIDQSFIRSA VGGDAGSSAI IHGTVTMARA LEIEITAEGI ETEADLLLAK       660
     ELGCTRAQGF YFAKPMDAEA VRQAIS                                            686
//

If you have problems or comments...

PBIL Back to PBIL home page