(data stored in ACNUC7421 zone)

EMBL: AP010803.PE359

AP010803.PE359       Location/Qualifiers
FT   CDS             complement(367549..368955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95193"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW1"
FT                   /protein_id="BAI95193.1"
FT                   /translation="MQFDQPLPEQLKNNPLRLGQSNLKAGLHGHLVELLAREVILNGQS
FT                   RGGKPLNTADAAFKAMGMIHRLDDKSWGLHGSRSDDIILQLSRIAFQQFPWQSPLTNGV
FT                   LARYHMLYAHPLVGPMVEAEFGMSTGELFQLILLFAEEMLQRPTLAFEFLPAAEQSIRA
FT                   PVLALSDRISRSSDDLRTATVERQSYDVNWAYSFNPLRAFPLVHAGNPRSLMCPAPPIL
FT                   LQRLTDGLYFDLIRADRRFGSAIGKAFEHYVGKVVERIGVDVFNLREETCWGKPERRSV
FT                   DWIVSDNSASLFVECKLGRLDIASQTEISPEPPFVAAIGRLAGNVGQLYATLSEALAGG
FT                   YPHWKPDGRPVHPIVVTFHEWFCFGPFFYKHLDELVDTEFEKRGLDRALLKRHPYCVCS
FT                   IAEFEGLLTAGRGANIDIVVSEKMSAAHRQSLMRGFLADRYPGSLSNAMGTFEDGMDLV
FT                   IEGPSRLTRR"
     MQFDQPLPEQ LKNNPLRLGQ SNLKAGLHGH LVELLAREVI LNGQSRGGKP LNTADAAFKA        60
     MGMIHRLDDK SWGLHGSRSD DIILQLSRIA FQQFPWQSPL TNGVLARYHM LYAHPLVGPM       120
     VEAEFGMSTG ELFQLILLFA EEMLQRPTLA FEFLPAAEQS IRAPVLALSD RISRSSDDLR       180
     TATVERQSYD VNWAYSFNPL RAFPLVHAGN PRSLMCPAPP ILLQRLTDGL YFDLIRADRR       240
     FGSAIGKAFE HYVGKVVERI GVDVFNLREE TCWGKPERRS VDWIVSDNSA SLFVECKLGR       300
     LDIASQTEIS PEPPFVAAIG RLAGNVGQLY ATLSEALAGG YPHWKPDGRP VHPIVVTFHE       360
     WFCFGPFFYK HLDELVDTEF EKRGLDRALL KRHPYCVCSI AEFEGLLTAG RGANIDIVVS       420
     EKMSAAHRQS LMRGFLADRY PGSLSNAMGT FEDGMDLVIE GPSRLTRR                    468
//

If you have problems or comments...

PBIL Back to PBIL home page