(data stored in ACNUC7421 zone)

EMBL: AP010803.PE361

AP010803.PE361       Location/Qualifiers
FT   CDS             complement(372654..373436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95195"
FT                   /db_xref="InterPro:IPR014976"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW3"
FT                   /protein_id="BAI95195.1"
FT                   /translation="MGLYERWCESTKAKDKRKRYWTYVEKDGGRDEIRDGLAETIRSHY
FT                   DRLERIAEDVDRLGYKVAAEILSEAMPQTAKGRSGDLGEILATELVEEEIGLRVPVRRL
FT                   RYKDGRNMAMRGDDFIGAGYDVAGEKLWLLKGEAKSNKVLGKATVTSARKVLNRDNGRC
FT                   TPDSLLFVANRLLESNDPGDNELGRSLRDEVGLKSLRADRIDHMLFTVSGNGPHASLKE
FT                   DLDATGTNRDHYVVNIHVEDHQDFIAAMYQEAEDLGDD"
     MGLYERWCES TKAKDKRKRY WTYVEKDGGR DEIRDGLAET IRSHYDRLER IAEDVDRLGY        60
     KVAAEILSEA MPQTAKGRSG DLGEILATEL VEEEIGLRVP VRRLRYKDGR NMAMRGDDFI       120
     GAGYDVAGEK LWLLKGEAKS NKVLGKATVT SARKVLNRDN GRCTPDSLLF VANRLLESND       180
     PGDNELGRSL RDEVGLKSLR ADRIDHMLFT VSGNGPHASL KEDLDATGTN RDHYVVNIHV       240
     EDHQDFIAAM YQEAEDLGDD                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page