(data stored in ACNUC7421 zone)

EMBL: AP010803.PE362

AP010803.PE362       Location/Qualifiers
FT   CDS             complement(373452..373997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95196"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW4"
FT                   /protein_id="BAI95196.1"
FT                   /translation="MTPPVYSQLFSCLYDQAEAVGQLGRGTHHSVFRSIQWRDIDGDFR
FT                   DSGRFHHFAVIWDEDHDARIIPMIEHLHMTGLLWPVVFIGERKGMLTVLLSHGIDPTKE
FT                   RSDWFDTVRDIAGHAIENDPWTVEFGTFHRDPANRDQLTEPAGLISDREELVVAYLQAI
FT                   DVLWQLGEERSERQQNQG"
     MTPPVYSQLF SCLYDQAEAV GQLGRGTHHS VFRSIQWRDI DGDFRDSGRF HHFAVIWDED        60
     HDARIIPMIE HLHMTGLLWP VVFIGERKGM LTVLLSHGID PTKERSDWFD TVRDIAGHAI       120
     ENDPWTVEFG TFHRDPANRD QLTEPAGLIS DREELVVAYL QAIDVLWQLG EERSERQQNQ       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page