(data stored in ACNUC7421 zone)

EMBL: AP010803.PE364

AP010803.PE364       Location/Qualifiers
FT   CDS             374681..375793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95198"
FT                   /db_xref="InterPro:IPR025332"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW6"
FT                   /protein_id="BAI95198.1"
FT                   /translation="MAAHKSHHYVPQFYMRLFSGTAAERVGVFIIAKERFIPKAPIKGQ
FT                   ACKDYFYGTDGHAEETFGAIENATAPILKSIVGGALPAPGSPDYHALMLYLAVQHSRTL
FT                   EAEAQLAEGSEHTMRAMLRTKFELEGNEEMLDWLELVRIKRNNAIGEAVMTGTIGAMLL
FT                   TDLALLLVQNDSDLPFIASDAPVVVHNRLFEATRSVGTAGYANLGLQIFLPLGPRLLLQ
FT                   CYDPAAYAAVDAAAGVVRFDDRATARLLNDLQWEAAGKVILTSPTMDQAELHSAATRWR
FT                   LQRGGPRMIHRQEIVSRTDTEVRVRQGVGPKPSDIALDLPFLAQTMPFPPPLGPYEVAP
FT                   SRDLDRDAMVREAWEDMMDLADRMHPPPPR"
     MAAHKSHHYV PQFYMRLFSG TAAERVGVFI IAKERFIPKA PIKGQACKDY FYGTDGHAEE        60
     TFGAIENATA PILKSIVGGA LPAPGSPDYH ALMLYLAVQH SRTLEAEAQL AEGSEHTMRA       120
     MLRTKFELEG NEEMLDWLEL VRIKRNNAIG EAVMTGTIGA MLLTDLALLL VQNDSDLPFI       180
     ASDAPVVVHN RLFEATRSVG TAGYANLGLQ IFLPLGPRLL LQCYDPAAYA AVDAAAGVVR       240
     FDDRATARLL NDLQWEAAGK VILTSPTMDQ AELHSAATRW RLQRGGPRMI HRQEIVSRTD       300
     TEVRVRQGVG PKPSDIALDL PFLAQTMPFP PPLGPYEVAP SRDLDRDAMV REAWEDMMDL       360
     ADRMHPPPPR                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page