(data stored in ACNUC7421 zone)

EMBL: AP010803.PE365

AP010803.PE365       Location/Qualifiers
FT   CDS             complement(375798..376499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95199"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW7"
FT                   /protein_id="BAI95199.1"
FT                   /translation="MRQWFFDLKAANRFTIGIDQTAVDWLSALLRHPSWQRWVFHPLQA
FT                   QLPNFDWKQAARHAFTEQFWPIFDYISGRRLRDTKARTKDLVARYASQEVFDPAALKAS
FT                   YDLTIQFATFIGRNSGLDFRRSKPDEYRWNGAPPALLALCALILFVSDWQLNTAIGKFA
FT                   QILTAPDPSDLLLGNVVGLNPFHDYAAWQMVVLAQEIAQQPTGVRVYDAELVRIEAELR
FT                   EAFRAWIQGQG"
     MRQWFFDLKA ANRFTIGIDQ TAVDWLSALL RHPSWQRWVF HPLQAQLPNF DWKQAARHAF        60
     TEQFWPIFDY ISGRRLRDTK ARTKDLVARY ASQEVFDPAA LKASYDLTIQ FATFIGRNSG       120
     LDFRRSKPDE YRWNGAPPAL LALCALILFV SDWQLNTAIG KFAQILTAPD PSDLLLGNVV       180
     GLNPFHDYAA WQMVVLAQEI AQQPTGVRVY DAELVRIEAE LREAFRAWIQ GQG              233
//

If you have problems or comments...

PBIL Back to PBIL home page