(data stored in ACNUC7421 zone)

EMBL: AP010803.PE367

AP010803.PE367       Location/Qualifiers
FT   CDS             complement(377013..378263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95201"
FT                   /db_xref="InterPro:IPR041229"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXW9"
FT                   /protein_id="BAI95201.1"
FT                   /translation="MIFAYGLAAVFVKHRIFMTGGDLTHTQAIELLDEAARELAEIRRG
FT                   KHYALWRDDKCRPLGDALRQVSPFDAYSDSWIFTGDGGGTIAHGRFGDWAIDRLVEKLE
FT                   PAAILAAFGEEIAGNVGHYSELSAILGVQLDTTVHLGDGVTLDAEPEDTFEGLIHRIPF
FT                   QMLPVPSGTSVLRHRYRVEPAFELRTAAPTGKSVTTPASPARDQVRQRVRLACLLASIG
FT                   PVELPFSLLQPDRASLFVAGDGNQAGRPFAAMPLVAFPVEGAAVKRAYGYLATFRGGAS
FT                   MARAIDRLGRSRLAINPVDRALDLGMAAEIALMHDHSHNNTEIAHKIGSRSAWLLGQTP
FT                   TDRATIFTEMKSLYGARSQAVHSGFLSSRSTIDLDAADALVTRIFNAILARGAFPDWSS
FT                   LVMGGDALQPVEDEDGA"
     MIFAYGLAAV FVKHRIFMTG GDLTHTQAIE LLDEAARELA EIRRGKHYAL WRDDKCRPLG        60
     DALRQVSPFD AYSDSWIFTG DGGGTIAHGR FGDWAIDRLV EKLEPAAILA AFGEEIAGNV       120
     GHYSELSAIL GVQLDTTVHL GDGVTLDAEP EDTFEGLIHR IPFQMLPVPS GTSVLRHRYR       180
     VEPAFELRTA APTGKSVTTP ASPARDQVRQ RVRLACLLAS IGPVELPFSL LQPDRASLFV       240
     AGDGNQAGRP FAAMPLVAFP VEGAAVKRAY GYLATFRGGA SMARAIDRLG RSRLAINPVD       300
     RALDLGMAAE IALMHDHSHN NTEIAHKIGS RSAWLLGQTP TDRATIFTEM KSLYGARSQA       360
     VHSGFLSSRS TIDLDAADAL VTRIFNAILA RGAFPDWSSL VMGGDALQPV EDEDGA           416
//

If you have problems or comments...

PBIL Back to PBIL home page