(data stored in SCRATCH zone)

EMBL: AP010803.PE368

AP010803.PE368       Location/Qualifiers
FT   CDS             378483..379403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95202"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX0"
FT                   /protein_id="BAI95202.1"
FT                   /translation="MIALGPSHHAHHLSGPFWWSLRGVATIYSLLSSNLKPTLGFAHQT
FT                   ASQRKADAFLLGEALTHWFAQTHLGAHMVVPLEAHTGFVVPHSTTAPYPKPMPKYFRHG
FT                   VKPGAKSEPDFLAFAGPGQIHVIESKGRAGFGHFGVADHVINAARNKALRQVCRIASVN
FT                   GIPPMTRTACVFAFDQSGLTGQITDPPANRPYHYRAEWPDLVRQAYASVLDPLFESSAR
FT                   DIGGNYVGIEFMPGWKFGIDRHVYKLVRSVEDAATMGRLLTFLSNFTSETDGVRIAEEY
FT                   SAGSDGLLLIGGPDFSTKGMRGALA"
     MIALGPSHHA HHLSGPFWWS LRGVATIYSL LSSNLKPTLG FAHQTASQRK ADAFLLGEAL        60
     THWFAQTHLG AHMVVPLEAH TGFVVPHSTT APYPKPMPKY FRHGVKPGAK SEPDFLAFAG       120
     PGQIHVIESK GRAGFGHFGV ADHVINAARN KALRQVCRIA SVNGIPPMTR TACVFAFDQS       180
     GLTGQITDPP ANRPYHYRAE WPDLVRQAYA SVLDPLFESS ARDIGGNYVG IEFMPGWKFG       240
     IDRHVYKLVR SVEDAATMGR LLTFLSNFTS ETDGVRIAEE YSAGSDGLLL IGGPDFSTKG       300
     MRGALA                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page