(data stored in ACNUC7421 zone)

EMBL: AP010803.PE369

AP010803.PE369       Location/Qualifiers
FT   CDS             379843..379986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95203"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX1"
FT                   /protein_id="BAI95203.1"
FT                   /translation="MISKNVIASLFVGVCCATPAPAQASNTYNANFVFQQTLPVITKGR
FT                   FP"
     MISKNVIASL FVGVCCATPA PAQASNTYNA NFVFQQTLPV ITKGRFP                      47
//

If you have problems or comments...

PBIL Back to PBIL home page