(data stored in ACNUC7421 zone)

EMBL: AP010803.PE37

AP010803.PE37        Location/Qualifiers
FT   CDS             37147..38103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94871"
FT                   /db_xref="GOA:D4YWY9"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWY9"
FT                   /protein_id="BAI94871.1"
FT                   /translation="MGRWRAALGIAIAIATSPLAAQDRAALDPDDPPAVIRTIPSGDTR
FT                   ITIPIQIDGRGPWNFVVDTGSQRTVISRALAERLDLPLRERVTVISMTGRAEVDTVAVP
FT                   RLGFGKTVVDDIEAPVLEGEHIGAAGLLGLDGLHAKRLLLNFRTGRMEISSSKRSWRDP
FT                   NVIVVEARRRQGQLILLDSDVNGMQVSIILDTGTSISVGNMALMNKLVRKKKAPALELV
FT                   TLTSVTGETLSGQAGLIDRVRMGQVMLKEMPVMFADAQPFAELGLHDKPALLLGIDALK
FT                   VFDRVAIDFGRGKVDFLLPDTGLLDRKRLATAGRAAG"
     MGRWRAALGI AIAIATSPLA AQDRAALDPD DPPAVIRTIP SGDTRITIPI QIDGRGPWNF        60
     VVDTGSQRTV ISRALAERLD LPLRERVTVI SMTGRAEVDT VAVPRLGFGK TVVDDIEAPV       120
     LEGEHIGAAG LLGLDGLHAK RLLLNFRTGR MEISSSKRSW RDPNVIVVEA RRRQGQLILL       180
     DSDVNGMQVS IILDTGTSIS VGNMALMNKL VRKKKAPALE LVTLTSVTGE TLSGQAGLID       240
     RVRMGQVMLK EMPVMFADAQ PFAELGLHDK PALLLGIDAL KVFDRVAIDF GRGKVDFLLP       300
     DTGLLDRKRL ATAGRAAG                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page