(data stored in ACNUC7421 zone)

EMBL: AP010803.PE370

AP010803.PE370       Location/Qualifiers
FT   CDS             complement(380034..380879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95204"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX2"
FT                   /protein_id="BAI95204.1"
FT                   /translation="MLRAYIDDSVSNTGDRRLVLAALIQSEATWAAFEVDWRRALAEPP
FT                   AIGYFKMAEAQNRRDQFKGFSEKERNRKVHALADIVARHAPWGFHASVSTTDYRELIEP
FT                   AAPFPMRTPYFLLFYAIVFGVARMHEALSVSEPCDFIFDQHSGLDKKTLPMLNDMIATS
FT                   SGSWGGQISGSVRFADDKDEVAIQASDLLAWLIRREGDGQLPPGCDGLMDKLVIYGVNR
FT                   FADVDRAWLEQISAGFSEIPRANSIDKQGWREMIPIWEGGHAKALNDAVIAAGLYPPED
FT                   "
     MLRAYIDDSV SNTGDRRLVL AALIQSEATW AAFEVDWRRA LAEPPAIGYF KMAEAQNRRD        60
     QFKGFSEKER NRKVHALADI VARHAPWGFH ASVSTTDYRE LIEPAAPFPM RTPYFLLFYA       120
     IVFGVARMHE ALSVSEPCDF IFDQHSGLDK KTLPMLNDMI ATSSGSWGGQ ISGSVRFADD       180
     KDEVAIQASD LLAWLIRREG DGQLPPGCDG LMDKLVIYGV NRFADVDRAW LEQISAGFSE       240
     IPRANSIDKQ GWREMIPIWE GGHAKALNDA VIAAGLYPPE D                           281
//

If you have problems or comments...

PBIL Back to PBIL home page