(data stored in ACNUC7421 zone)

EMBL: AP010803.PE373

AP010803.PE373       Location/Qualifiers
FT   CDS             382029..382649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95207"
FT                   /db_xref="InterPro:IPR025311"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX5"
FT                   /protein_id="BAI95207.1"
FT                   /translation="MRFRALLGAEAWDRLPRAVRSRFAKRLLPGRSVGYAGQVMTCRMR
FT                   PLGWLLAQACRLIGSPLPLGRDSGMAAVVTVTEDGASGGQVWTRMYARPRGFPQVIHSA
FT                   KRFAGPTGLEEYLGAGFGIALTVEASATGIRFRSHHYFLCIGALRLRLPRWIAPGALSI
FT                   DHEDMGEGSFAFTLSLRHPLLGELIRQVGHFHDQPASQQEVQP"
     MRFRALLGAE AWDRLPRAVR SRFAKRLLPG RSVGYAGQVM TCRMRPLGWL LAQACRLIGS        60
     PLPLGRDSGM AAVVTVTEDG ASGGQVWTRM YARPRGFPQV IHSAKRFAGP TGLEEYLGAG       120
     FGIALTVEAS ATGIRFRSHH YFLCIGALRL RLPRWIAPGA LSIDHEDMGE GSFAFTLSLR       180
     HPLLGELIRQ VGHFHDQPAS QQEVQP                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page