(data stored in ACNUC7421 zone)

EMBL: AP010803.PE374

AP010803.PE374       Location/Qualifiers
FT   CDS             382646..384148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03740"
FT                   /product="SulA-family protein"
FT                   /note="putative nucleoside-diphosphate sugar epimerase
FT                   (SulA family) / cell division inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95208"
FT                   /db_xref="GOA:D4YXX6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX6"
FT                   /protein_id="BAI95208.1"
FT                   /translation="MTTTLWLFIALQMTMGAFDTFYHHEGTERLAWRPGQSVELRLHGI
FT                   RNLAYMLAFACLGWTIPKGGWAIALILLLAGELFITLWDFVEEDRTRHLPATERITHTL
FT                   LTLNYGVILAMLIPRLLDWAGEPSAIMPVHYGMMSWFCAIAAFGVFVSGLRDLAAARRC
FT                   PRLVPADPAPLAAALGHSKTVLVTGGTGFVGSRLVEALASAGHDVTVLARDRARAAPLL
FT                   QAGPVRIITSLDAISPDTRIDAIVNLAGEPISNSPWTRAKRQRIVRSRMGMTQNVLRLI
FT                   QRLHHRPEVLVSGSAIGIYGLRGDEKLDESDEGKPCFSRHVCLNWERAARRAEGLGVRT
FT                   VYLRTGLVLDASGGMLARMLAPFEYGLGGRFGDGRHWMSWIHRDDLVRLIVHCLARPEI
FT                   NGPVNGTAPVPVTNRTFTAALGRALHRPAMLPVPAWPLRRLLSGFAEELLLNGQRVLPA
FT                   VATRSGFSFRYPNLDVALAAITGGDKMILTDVPVRPLALKEG"
     MTTTLWLFIA LQMTMGAFDT FYHHEGTERL AWRPGQSVEL RLHGIRNLAY MLAFACLGWT        60
     IPKGGWAIAL ILLLAGELFI TLWDFVEEDR TRHLPATERI THTLLTLNYG VILAMLIPRL       120
     LDWAGEPSAI MPVHYGMMSW FCAIAAFGVF VSGLRDLAAA RRCPRLVPAD PAPLAAALGH       180
     SKTVLVTGGT GFVGSRLVEA LASAGHDVTV LARDRARAAP LLQAGPVRII TSLDAISPDT       240
     RIDAIVNLAG EPISNSPWTR AKRQRIVRSR MGMTQNVLRL IQRLHHRPEV LVSGSAIGIY       300
     GLRGDEKLDE SDEGKPCFSR HVCLNWERAA RRAEGLGVRT VYLRTGLVLD ASGGMLARML       360
     APFEYGLGGR FGDGRHWMSW IHRDDLVRLI VHCLARPEIN GPVNGTAPVP VTNRTFTAAL       420
     GRALHRPAML PVPAWPLRRL LSGFAEELLL NGQRVLPAVA TRSGFSFRYP NLDVALAAIT       480
     GGDKMILTDV PVRPLALKEG                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page