(data stored in SCRATCH zone)

EMBL: AP010803.PE375

AP010803.PE375       Location/Qualifiers
FT   CDS             384148..385011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03750"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95209"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX7"
FT                   /protein_id="BAI95209.1"
FT                   /translation="MTMANALFLPPTEYLRHMLVRRIQNVFNDRDRGERPVVRSDNALY
FT                   PRQSVIWRVHGDVTTMMIGGVTALLLQMLHPAALAGVWDHSGFRGDMLGRLRRTARFIA
FT                   VTTFGDRAEAEAAIDRVRQVHERVKGVLPDGTPYAATDPRLLAWVHVCEAMGFLDAWIA
FT                   FAEPGMSRANQDRYFKQAAQIARALGADPVPESRAEAEALMTSFLPELKADTRTRAVAR
FT                   MILSQPAPSTAMRPAQSMLMQASVDILPPWAKQLHGFPARPLASPLVRASAFIIAHTLR
FT                   WAFNRS"
     MTMANALFLP PTEYLRHMLV RRIQNVFNDR DRGERPVVRS DNALYPRQSV IWRVHGDVTT        60
     MMIGGVTALL LQMLHPAALA GVWDHSGFRG DMLGRLRRTA RFIAVTTFGD RAEAEAAIDR       120
     VRQVHERVKG VLPDGTPYAA TDPRLLAWVH VCEAMGFLDA WIAFAEPGMS RANQDRYFKQ       180
     AAQIARALGA DPVPESRAEA EALMTSFLPE LKADTRTRAV ARMILSQPAP STAMRPAQSM       240
     LMQASVDILP PWAKQLHGFP ARPLASPLVR ASAFIIAHTL RWAFNRS                     287
//

If you have problems or comments...

PBIL Back to PBIL home page