(data stored in ACNUC7421 zone)

EMBL: AP010803.PE377

AP010803.PE377       Location/Qualifiers
FT   CDS             complement(385607..386959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03770"
FT                   /product="putative iron uptake protein"
FT                   /note="uncharacterized iron-regulated membrane protein /
FT                   PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95211"
FT                   /db_xref="GOA:D4YXX9"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXX9"
FT                   /protein_id="BAI95211.1"
FT                   /translation="MTTIAPESSTVKRALSAHAAIGLLAGALLYIVSLSGTLAVFYQEF
FT                   QRIEQPRAPEMASIDPQAVQRGIEAVLAREKGKPLATHLYVHLPVEGLPRTVITTDTQA
FT                   VHIDRTGKIAGKEEIAWSDFLAQLHYMLNIPGLFGFILVGILGVMMLTLSLSGVIAHPR
FT                   IFRDAFRLRARDKGGLGLADWHNRMSVWTLPFILAISLTGALIGTADLTAYGIGATGYK
FT                   GDMEAVYASIFGPEGKPDTKAAPAPNIAAALDYMAAHYPGRRLTYVTLHDPLTAGQHVQ
FT                   IVGTFERRLVFGEYYNFDAAGRVIGRAGISDGPAGRQMAASNYNLHFGNFGGLPVKMAY
FT                   FILGMALTAICATGTYIWLGKRERRGIGAPRIRAAWDAVVWGAPLILALAFVLRKTLGN
FT                   DLPLVAIFWGGLAAILVGAWFFAAPGQIAKLLKRALVLACGLGSALALAGF"
     MTTIAPESST VKRALSAHAA IGLLAGALLY IVSLSGTLAV FYQEFQRIEQ PRAPEMASID        60
     PQAVQRGIEA VLAREKGKPL ATHLYVHLPV EGLPRTVITT DTQAVHIDRT GKIAGKEEIA       120
     WSDFLAQLHY MLNIPGLFGF ILVGILGVMM LTLSLSGVIA HPRIFRDAFR LRARDKGGLG       180
     LADWHNRMSV WTLPFILAIS LTGALIGTAD LTAYGIGATG YKGDMEAVYA SIFGPEGKPD       240
     TKAAPAPNIA AALDYMAAHY PGRRLTYVTL HDPLTAGQHV QIVGTFERRL VFGEYYNFDA       300
     AGRVIGRAGI SDGPAGRQMA ASNYNLHFGN FGGLPVKMAY FILGMALTAI CATGTYIWLG       360
     KRERRGIGAP RIRAAWDAVV WGAPLILALA FVLRKTLGND LPLVAIFWGG LAAILVGAWF       420
     FAAPGQIAKL LKRALVLACG LGSALALAGF                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page