(data stored in ACNUC7421 zone)

EMBL: AP010803.PE379

AP010803.PE379       Location/Qualifiers
FT   CDS             complement(387534..389711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03790"
FT                   /product="outer membrane receptor for ferric iron uptake"
FT                   /note="iron complex outermembrane recepter protein / outer
FT                   membrane receptor for ferric coprogen and
FT                   ferric-rhodotorulic acid / outer membrane receptor protein,
FT                   mostly Fe transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95213"
FT                   /db_xref="GOA:D4YXY1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXY1"
FT                   /protein_id="BAI95213.1"
FT                   /translation="MKSIKSLLLGSVAMSFCAAAQAQEAAPGSDDQGAIVVTGTYTLDH
FT                   SIDTATGLGLALRETPQSVSVMTAQRILDQNLITVKDVIQNGVGVAVNEVDDVRNSFYA
FT                   RGFEIRNTQIDGVPAAWTLAGANGETSADVSIYERVEIVRGATGFLSGAGDPSASVNLV
FT                   RKHADFADFKGYLNAGVGSWDSWRLSADLGGALTPDGRVRARVVGRYERGKSYIDIQDR
FT                   KKWVLYGVVEADVTDSTLVRVGISHQDTKPSGATWGALPTFYSDGTTTFLPRSQTTAAD
FT                   WTYWNTTNQNIFATVRQAFGERWSLTVNYNRLKNSGDTQLLYLYGNVNKATGTIDSSNP
FT                   YKSTGESVQESFDGQLKGEVSLFGRDHEVVLGALHSILNRHTDNFVAPYTRNNPAWGAG
FT                   LNDWANNVPLVGEVGVPFPEPVWGTTPVRNEQERIKQTGYYAAVRLNIADPFKAVVGGR
FT                   LASWHQTGFAWSGPSDYGNDDVFIPYVGALLDVAPNHRLYASYTRIFQPQNLLDRNLRQ
FT                   LDPLNGNAFEIGVKSSFFGDKFQTSIALFQIKQDNVGQPDIMVTPPGGGLPQQTYVAAE
FT                   GITSKGVELEATGQLLPGWNVNASYSRFWADYSNGAPANTDQPRKLLKVFTTYSFPVLG
FT                   RDLTLGGGVNYRGVAYSTGANPVTLAPFRFTQGAYTLVSVMARYNITDQVEIQANVENL
FT                   LDKTYFSQVGFYSQYRYGAPRNFTVGATYRF"
     MKSIKSLLLG SVAMSFCAAA QAQEAAPGSD DQGAIVVTGT YTLDHSIDTA TGLGLALRET        60
     PQSVSVMTAQ RILDQNLITV KDVIQNGVGV AVNEVDDVRN SFYARGFEIR NTQIDGVPAA       120
     WTLAGANGET SADVSIYERV EIVRGATGFL SGAGDPSASV NLVRKHADFA DFKGYLNAGV       180
     GSWDSWRLSA DLGGALTPDG RVRARVVGRY ERGKSYIDIQ DRKKWVLYGV VEADVTDSTL       240
     VRVGISHQDT KPSGATWGAL PTFYSDGTTT FLPRSQTTAA DWTYWNTTNQ NIFATVRQAF       300
     GERWSLTVNY NRLKNSGDTQ LLYLYGNVNK ATGTIDSSNP YKSTGESVQE SFDGQLKGEV       360
     SLFGRDHEVV LGALHSILNR HTDNFVAPYT RNNPAWGAGL NDWANNVPLV GEVGVPFPEP       420
     VWGTTPVRNE QERIKQTGYY AAVRLNIADP FKAVVGGRLA SWHQTGFAWS GPSDYGNDDV       480
     FIPYVGALLD VAPNHRLYAS YTRIFQPQNL LDRNLRQLDP LNGNAFEIGV KSSFFGDKFQ       540
     TSIALFQIKQ DNVGQPDIMV TPPGGGLPQQ TYVAAEGITS KGVELEATGQ LLPGWNVNAS       600
     YSRFWADYSN GAPANTDQPR KLLKVFTTYS FPVLGRDLTL GGGVNYRGVA YSTGANPVTL       660
     APFRFTQGAY TLVSVMARYN ITDQVEIQAN VENLLDKTYF SQVGFYSQYR YGAPRNFTVG       720
     ATYRF                                                                   725
//

If you have problems or comments...

PBIL Back to PBIL home page