(data stored in ACNUC7421 zone)

EMBL: AP010803.PE380

AP010803.PE380       Location/Qualifiers
FT   CDS             389989..390390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95214"
FT                   /db_xref="GOA:D4YXY2"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXY2"
FT                   /protein_id="BAI95214.1"
FT                   /translation="MKRYAYGWITALFFLVSIAAHWIFGWYAFVEEAREHGQLVEVGSY
FT                   LVEMGRDTFENWQSEFLQLIWQVVGLAYFLYVGSPASKENDDRLEAKVDELMKLVGGEK
FT                   AEAMIAAIDERYLRTHGHAQPHAHDVGHE"
     MKRYAYGWIT ALFFLVSIAA HWIFGWYAFV EEAREHGQLV EVGSYLVEMG RDTFENWQSE        60
     FLQLIWQVVG LAYFLYVGSP ASKENDDRLE AKVDELMKLV GGEKAEAMIA AIDERYLRTH       120
     GHAQPHAHDV GHE                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page